PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G065500.1
Common NamePHAVU_004G065500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 248aa    MW: 28049.1 Da    PI: 5.1373
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G065500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.76.2e-09181225448
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         WT+ E+ l++ + +   +g+Wk+I++     +t+ q+ s+  ky+
  Phvul.004G065500.1 181 WTENEHRLFLIGLQNCTPGNWKKISKDYIPSKTPTQIASHAKKYR 225
                         *************************98877*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.35173229IPR017930Myb domain
SuperFamilySSF466891.05E-13175229IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-12176228IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-7180222IPR009057Homeodomain-like
PfamPF002491.2E-7180225IPR001005SANT/Myb domain
CDDcd001671.82E-6181224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MDCEINNDNS DIISIDDEID RILGLTDEWK KDDDVVSMTD DDINEMFGLT DDDVVSITDD  60
DMNEMFDMTD DEIISTSNEV CVRASRVSIS NVSPYQSTPF KDNGKAASEF PTPTIQPISP  120
DVFCYNHAPT PSKVSTTHVS AISPNTITSE HVPSGWVQMP NYSNHSTPPV LKSHHKQYEH  180
WTENEHRLFL IGLQNCTPGN WKKISKDYIP SKTPTQIASH AKKYRLHQNG LKKNKKRKSI  240
HDISLKNT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151662.10.0hypothetical protein PHAVU_004G065500g, partial
TrEMBLV7C4480.0V7C448_PHAVU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1852625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-23MYB family protein